caripe 3 cDNA [plantlet](177) Nucleic Acid Card

General Information
Name caripe 3 cDNA [plantlet]
Sequence TGTGGTGAATCGTGCGTTTTTATTCCCTGCATCTCTGCTG
TTGTGGGCTGCAGTTGCTCAAATAAAGTCTGCTATAACAA
TGGACTAAGTTCCTGAGAGTATTTAATGCGGTGGGCGTTG
CGGACCTGCCTTAAATCTTTCTGGTGGCTTTCATGAAATT
CTGTGTGTCAACAATAATAATTATCCTTACAATTGCTTCT
CAGGCGACATTGGGATTTACTATATTTGT
Notes Retrieved from the 1KP project. The accession number was scaffold-BQEQ-2047075-Psychotria_ipecacuanha-invitro_plantlet, which is different from the ones provided by Koehbach et al. Minor credit should be given to the 1KP project if using this sequence http://www.onekp.com/.
Sequence translation CGESCVFIPCISAVVGCSCSNKVCYNNGLSS
Organism Carapichea ipecacuanha

References
Koehbach,J., Attah,A.F., Berger,A., Hellinger,R., Kutchan,T.M., Carpenter,E.J., Rolf,M., Sonibare,M.A., Moody,J.O., Wong,G.K., Dessein,S., Greger,H. and Gruber,C.W. (2013) Cyclotide discovery in Gentianales revisited-identification and characterization of cyclic cystine-knot peptides and their phylogenetic distribution in Rubiaceae plants. Biopolymers 100:438-452

Cross-references
Proteins Encoded caripe3 precursor [partial]
Links