Momordica cochinchinensis two inhibitor peptide topologies precursor 1 (TIPTOP1) mRNA, complete cds(171) Nucleic Acid Card

General Information
Name Momordica cochinchinensis two inhibitor peptide topologies precursor 1 (TIPTOP1) mRNA, complete cds
Sequence AAGGAAGAAAACGTCTTGCTAGAGAAAGGGAGTTGAAATG
GAGAGCAAGAAGATTCTTCCGGTGGTGCTGGTGGCGATGA
TGCTGGTCGCAACCTCGACAGGCTTCAACGACGGCGACAC
AATAGAACTCATCTCCGACGGTCGAGCTCAAATAGATATC
AACGGTGGTGTCTGTCCCAAAATCTTGCAGAGATGCAGGC
GCGACTCCGATTGCCCCGGTGCATGTATTTGCCGGGGGAA
CGGGTATTGCGGTAGCGGTAGCGACGCGTTAGAAGGCCTC
ATGTCCGACGGTCGAGCCCAAATCGACATTAACGGTGGTG
TCTGTCCCAAAATCTTGAAGAAATGCAGGCGGGACTCCGA
TTGCCCCGGTGCATGTATTTGCCGGGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGAAGGCCTCATGTCCGACG
GTCGAGCCCAAATCGACATTAACGGTGGTGTCTGTCCCAA
AATCTTGAAGAAATGCAGGCGGGACTCCGATTGCCCCGGT
GCATGTATTTGCCGGGGGAACGGGTATTGCGGTAGCGGTA
GCGACGCGTTAGAAGGCCTCATGTCCGACAGTCGAGCCCA
AATCGACATTAACGGTGGTGTCTGTCCCAAAATCTTGAAG
AAATGCAGGCGCGACTCCGATTGCCCCGGTGCATGTATTT
GCCGGGGAAACGGGTATTGCGGTAGCGGTAGCGACGCGAT
AGACCTCATCTACGACGCTGGAGCTCAAACTGGCGAAGAC
ATTAATGGCGGTGGAGTGTATGACGAGAAACAAAGAGCCT
GTCCTAGAATCTTAAAGAAATGCAGACGTGACTCGGATTG
CCCAGGTGAATGTATTTGCAAGGGGAATGGGTATTGTGGT
TAATATATATGGTATCACTGGATAAAGCTCTGAAAAGTGA
AAGCTATGCTGTTTCTGAAAAATAAAATGTCTCGAAATGA
TAGTATCACAGTGTGTGTATGTGATCAATATCATTTAAGA
GTGCATAAATAAAAATATGTAAAATGTTGTGTGTCTTTGT
GTTTCGAACCTGTTTTTAATAAAGTGAGAATATGAGTGTT
GTTTTC
Notes
Sequence translation MESKKILPVVLVAMMLVATSTGFNDGDTIELISDGRAQID
INGGVCPKILQRCRRDSDCPGACICRGNGYCGSGSDALEG
LMSDGRAQIDINGGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSDALEGLMSDGRAQIDINGGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSDALEGLMSDSRAQIDINGGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSDAIDLIYDAGAQTGE
DINGGGVYDEKQRACPRILKKCRRDSDCPGECICKGNGYC
G
Organism Momordica cochinchinensis

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Proteins Encoded TIPTOP1
Links