Momordica cochinchinensis two inhibitor peptide topologies precursor 2 (TIPTOP2) mRNA, complete cds(170) Nucleic Acid Card

General Information
Name Momordica cochinchinensis two inhibitor peptide topologies precursor 2 (TIPTOP2) mRNA, complete cds
Sequence AAGGAAGAAAACGTCTTGCTAGAGAAAGGGAGTTGAAATG
GAGAGCAAGAAGATTCTTCCGGTGGTGCTGGTGGCGATGA
TGCTGGTCGCAACCTCGACAGGCTTCAACGACGGCGACAC
AATAGAACTCATCTCCGACGGTCGAGCTCAAATAGATATC
AACGGTGGTGTCTGTCCCAAAATCTTGCAGAGATGCAGGC
GCGACTCCGATTGCCCCGGTGCATGTATTTGCCGGGGGAA
CGGGTATTGCGGTAGCGGTAGCGACGCGTTAGAAGGCCTC
ATGTCCGACGGTCGAGCCCAAATCGACATTAACGGTGGTG
TCTGTCCCAAAATCTTGAAGAAATGCAGGCGGGACTCCGA
TTGCCCCGGTGCATGTATTTGCCGGGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGAAGGCCTCATGTCCGACA
GTCGAGCCCAAATCGACATTAACGGTGGTGTCTGTCCCAA
AATCTTGAAGAAATGCAGGCGCGACTCCGATTGCCCCGGT
GCATGTATTTGCCGGGGGAACGGGTATTGCGGTAGCGGTA
GCGACGCTTTAGAAGGCCTCATGTCCGACGGTCGAGCCCA
AATCGACATTAACGGTGGTGTCTGTCCCAAAATCTTGAAG
AAATGCCGGCGCGACTCCGATTGCCCCGGTGCATGTATTT
GCCGGGGAAACGGGTATTGCGGTAGCGGTAGCGACGCGAT
AGACGGCCTCATATCCGACGGTCGAGCCCAAATCGACATT
AACGGTGGTGCCTGTCCCAGAATCTTGAAGAAATGCAGGC
GCGACTCTGATTGCCCCGGTGCATGTGTTTGCCAGGGGAA
CGGGTATTGTGGTAGCGGTAGCGACGCGATAGACCTCATC
TACGACGCTGGAGCTCAAACTGGCGAAGACATTAATGGCG
GTGGAGTGTATGACGAGAAACAAAGAGCCTGTCCTAGAAT
CTTAAAGAAATGCAGACGTGACTCGGATTGCCCAGGTGAA
TGTATTTGCAAGGGGAATGGGTATTGTGGTTAATATATAT
GGTATCACTGGATAAAGCTCTGAAAAGTGAAAGCTATGCT
GTTTCTGAAAAATAAAATGTCTCGAAATGATAGTATCACA
GTGTGTGTATGTGATCAATATCATTTAAGAGTGCATAAAT
AAAAATATGTAAAATGTTGTGTGTCTTTGTGTTTCGAACC
TGTTTTTAATAAAGTGAGAATATGAGTGTTGTTTTC
Notes
Sequence translation MESKKILPVVLVAMMLVATSTGFNDGDTIELISDGRAQID
INGGVCPKILQRCRRDSDCPGACICRGNGYCGSGSDALEG
LMSDGRAQIDINGGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSDALEGLMSDSRAQIDINGGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSDALEGLMSDGRAQIDINGGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSDAIDGLISDGRAQID
INGGACPRILKKCRRDSDCPGACVCQGNGYCGSGSDAIDL
IYDAGAQTGEDINGGGVYDEKQRACPRILKKCRRDSDCPG
ECICKGNGYCG
Organism Momordica cochinchinensis

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Proteins Encoded TIPTOP2
Links