circularin A precursor gene(17) Nucleic Acid Card

General Information
Name circularin A precursor gene
Sequence TCATGTAAAAATGTAATTGCAAGTGATTAAATAGTTTCTT
GCGATTATATTGATAACATATCAATATATCAGTTTTTCAA
AAGGAGGTGATTAATTATGTTTTTAGTTGCAGGAGCACTA
GGCGTGCAAACAGCTGCAGCTACTACAATTGTTAATGTTA
TTCTTAATGCAGGTACATTAGTTACTGTTTTAGGTATTAT
AGCTTCAATTGCAAGTGGTGGTGCAGGTACATTAATGACT
ATTGGATGGGCAACATTCAAAGCAACAGTTCAAAAATTAG
CTAAGCAAAGTATGGCAAGAGCTATAGCTTACTAATCAAA
ATTTATGATTTTAATTAAATGGATAGCTTGCTACAGACAG
GCTATCTATTTAATTAAATGAATAAAAAATCTTGTATTTA
Notes
Sequence translation MFLVAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIAS
GGAGTLMTIGWATFKATVQKLAKQSMARAIAY
Organism Clostridium beijerinckii

References
Kemperman R, Kuipers A, Karsens H, Nauta A, Kuipers O, Kok J (2003) Identification and characterization of two novel clostridial bacteriocins, circularin A and closticin 574. Appl Environ Microbiol 69:1589-97

Cross-references
Proteins Encoded circularin A
circularin A precursor protein
Links