Momordica cochinchinensis two inhibitor peptide topologies precursor 3 (TIPTOP3) mRNA, complete cds(169) Nucleic Acid Card

General Information
Name Momordica cochinchinensis two inhibitor peptide topologies precursor 3 (TIPTOP3) mRNA, complete cds
Sequence AAGGAAGAAAACGTCTTGCTAGAGAAAGGGAGTTGAAATG
GAGAGCAAGAAGATTCTTCCGGTGGTGCTGGTGGCGATGA
TGCTGGTCGCAACCTCGACAGGCTTCAACGACGGCGACAC
AATAGACCTCATCTCCGACGGTCGAGCTCAAATAGACATC
AACGGTGGTGTCTGTCCCAAAATCTTGCAGAGATGCAGGC
GCGACTCCGATTGCCCCGGTGCATGTATTTGCCTGGGGAA
CGGGTATTGCGGTAGCGGTAGCGACGCGTTAGAAGGCCTC
GTGTCCGACGGTCGAGCCCAAATCGACATTAACGGTGGTG
TCTGTCCCAAAATCTTGAAGAAATGCAGGCGCGACTCCGA
TTGCCCCGGTGCATGTATTTGCCGGGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGAAGGCCTCATGTCGGACG
GTCAGGCCCAAATCGACATTAACGGTGGTGTCTGTCCCAA
AATCTTGAAGAAATGCAGGCGCGACTCCGATTGCCCCGGT
GCATGTATTTGCCGGGGGAACGGGTATTGCGGTAGCGGTA
GCGACGCGTTAGAAGGCCTCATGTCCGACGGTCGAGCCCA
AATCGACATTAACGGTGGTGTTTGTCCCAAAATCTTGAAG
AAATGCAGGCGCGACTCCGATTGCCCCGGTGCATGTATTT
GCCGGGGGAACGGGTATTGCGGTAGCGGTAGCGACGCGTT
AGAAGGCCTCATGTCCGACGGTCGAGCCCAAATCGACATT
AACGGTGGTGTTTGTCCCAAAATCTTGAAGAAATGCAGGC
GCGACTCCGATTGCCCCGGTGCATGTATTTGCCGGGGGAA
CGGGTATTGCGGTAGCGGTAGCGACGCGTTAGAAGGCCTC
ATGTCCGACGGTCGAGCCCAAATCGACATTAACGGTGGTG
TTTGTCCCAAAATCTTGAAGAAATGCAGGCGCGACTCCGA
TTGCCCCGGTGCATGTATTTGCCGGGGGAACGGGTATTGC
GGTAGCGGTAGCGACGCGTTAGAAGGCCTCATGTCCGACG
GTCGAGCCCAAATCGACATTAACGGTGGTGCCTGTCCCAG
AATCTTGAAGAAATGCAGGCGCGACTCTGATTGCCCCGGT
GCATGTGTTTGCAAGGGGAACGGGTATTGTGGTAGCGGAA
GCGACGCGATAGACCTCATCTCCGACGCTGGAGCTCAAAC
TGGCGAAGACATTAATGGCGGTGGAGTGTATGACGAGAAA
CAAAGAGCCTGTCCTAGAATCTTAAAGAAATGCAGACGTG
ACTCGGATTGCCCAGGTGAATGTATTTGCCAGGGGAATGG
GTATTGTGGTTAATACATATGGTATTACTGGATAAAGCTC
TGAAAAGTGAAAGCTATGCTGTTTCTGAAAAATAAAATGT
CTCGAAATGATAGTATCACAGTGTCTGTGTATGTGATCAA
TATCATTGAAGAGTGCATAAATAAAAATATGTAAAATGTT
GTGTGTCTGTGCGTTTCGAACCTGTTTTTAATAAAGTGAG
AATATGAGTGTTGTTTT
Notes
Sequence translation MESKKILPVVLVAMMLVATSTGFNDGDTIDLISDGRAQID
INGGVCPKILQRCRRDSDCPGACICLGNGYCGSGSDALEG
LVSDGRAQIDINGGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSDALEGLMSDGQAQIDINGGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSDALEGLMSDGRAQIDINGGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSDALEGLMSDGRAQID
INGGVCPKILKKCRRDSDCPGACICRGNGYCGSGSDALEG
LMSDGRAQIDINGGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSDALEGLMSDGRAQIDINGGACPRILKKCRRDSDCP
GACVCKGNGYCGSGSDAIDLISDAGAQTGEDINGGGVYDE
KQRACPRILKKCRRDSDCPGECICQGNGYCG
Organism Momordica cochinchinensis

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Proteins Encoded TIPTOP3
Links