Steinchisma laxum panitide L2 mRNA, complete cds(168) Nucleic Acid Card

General Information
Name Steinchisma laxum panitide L2 mRNA, complete cds
Sequence ACATGGGGACACCAAACAAGCACAGAGAAATACTCCTAGT
CCCCAAGAGCAAGAGTGCAGTATGGAGACCGGCAAGAGAG
TTGCTGGCATGGTGGCCGTAGTGCTGCTTCTGCAGCTAAT
GGCAGCTCCGATCACCATGGCACGCAATGTGGCAGTGGAC
GAAAACACTCCCCTCGTGGGTTTACTGGATATTGCTATGG
AGGTTAACCACAACCAGCTACCAATTTGTGGGGAAACTTG
TGTCTTGGGAAGATGCTACACTCCCAATTGCAGGTGCCAG
TATCCTATCTGTGTCAGGTGATGGTTGCTTCTCTTTTCAA
GATTGAAGTCATGCCCATCATGAATCCTGGTTGTCTGTTG
TTCCATTACATATAGTTTTTAAATTATCTGTAAGTGGGTG
GGGAGGATGAGAAGAGTGGTGCTGTACTTTTTATATATGG
TGTGATTAAATAAATGGGGCATGTTGGATGTGT
Notes
Sequence translation METGKRVAGMVAVVLLLQLMAAPITMARNVAVDENTPLVG
LLDIAMEVNHNQLPICGETCVLGRCYTPNCRCQYPICVR
Organism Panicum laxum

References
Nguyen,G.K., Lian,Y., Pang,E.W., Nguyen,P.Q., Tran,T.D. and Tam,J.P. (2013) Discovery of linear cyclotides in monocot plant Panicum laxum of Poaceae family provides new insights into evolution and distribution of cyclotides in plants. J. Biol. Chem. 288:3370-3380

Cross-references
Proteins Encoded Panitide L2 precursor
Links