Clitoria ternatea cyclotide precursor cliotide T1 mRNA, partial cds(162) Nucleic Acid Card

General Information
Name Clitoria ternatea cyclotide precursor cliotide T1 mRNA, partial cds
Sequence ATCCCATGTGGGGAAAGTTGTGTATTTATTCCATGCATAA
CAGGAGCCATCGGTTGTTCTTGTAAAAGCAAAGTTTGCTA
TCGAAACCATGTCATTGCAGCTGAGGCAAAGACAATGGAT
GATCATCATCTCTTATGTCAATCTCATGAAGATTGCATCA
CTAAAGGAACTGGAAACTTTTGTGCTCCTTTCCCTGATCA
AGATATTAAATATGGTTGGTGTTTCCGTGCTGAGTCTGAA
GGATTCATGTTGAAAGACCACTTAAAGATGTCTATCACCA
ACTGAAAGTAGTCATGTATGCATAATGAATCTACTATTAC
AAAAAGATACACATGATGCATGTACTATCTTAAATAAATG
GTTGTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
Notes
Sequence translation IPCGESCVFIPCITGAIGCSCKSKVCYRNHVIAAEAKTMD
DHHLLCQSHEDCITKGTGNFCAPFPDQDIKYGWCFRAESE
GFMLKDHLKMSITN
Organism Clitoria ternatea L

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Proteins Encoded Cter P precursor (variant) [partial]
Links