Lactobacillus gasseri DNA for Gassericin A(16) Nucleic Acid Card

General Information
Name Lactobacillus gasseri DNA for Gassericin A
Sequence AAGCTTGAGAAGAAAGATACCGATAAGGCCTTATTGATTT
ACACGATGGTCATTTTTGTTGTCAATTCTATTCTCCCGAT
ATTTTCACTTTTAGGAAGGTAGCATGTAGGTAAATAATCT
TTAAGGAGGCAAATCAGGCATGGATAAGAAAACAAAAATA
TTATTTGAAGTATTATACATTATCTGTATAATAGGCCCTC
AATTTATATTATTTGTGACTGCAAAAAACAATATGTATCA
GTTGGTGGGTTCGTTTGTTGGAATAGTATGGTTTTCGTAT
ATTTTTTGGTATATTTTTTTCAAACAACATAAAAAAATGT
AGTATACCACTTGTTTATTGATTTATTAAGGGCTTATAAT
AGTGATATAATATTTATTACAAAAAGGTACGTACACTCGT
AATGGATTTCCTATGGGAGGAAGATACTATGGTTACTAAG
TACGGACGTAATTTAGGTTTGAACAAGGTAGAGTTGTTTG
CAATTTGGGCGGTTTTAGTAGTTGCTCTTTTATTGACCAC
AGCGAACATTTATTGGATTGCTGATCAATTCGGGATTCAT
TTAGCGACTGGAACAGCCCGTAAGTTATTAGATGCAATGG
CTTCTGGTGCCTCATTGGGAACTGCCTTTGCTGCTATTTT
GGGCGTGACATTACCTGCATGGGCTTTGGCAGCTGCAGGA
GCATTGGGAGCGACTGCAGCCTAGTGATTATAAAGCTT
Notes
Sequence translation MVTKYGRNLGLNKVELFAIWAVLVVALLLTTANIYWIADQ
FGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWAL
AAAGALGATAA
Organism Lactobacillus gasseri LA39

References
Kawai Y, Saito T, Suzuki M, Itoh T (1998) Sequence analysis by cloning of the structural gene of gassericin A, a hydrophobic bacteriocin produced by Lactobacillus gasseri LA39. Biosci Biotechnol Biochem 62:887-92

Cross-references
Proteins Encoded gassericin A
gassericin A precursor protein
Links