Clitoria ternatea cyclotide precursor cliotide T8 mRNA, complete cds(156) Nucleic Acid Card

General Information
Name Clitoria ternatea cyclotide precursor cliotide T8 mRNA, complete cds
Sequence ATGGCTTACGTTAGGCTTGCTTGTCTCGCTGTGATCTTCT
TTTTTGCTGCTTCTGTTATGTTTACAGTGGAAGCTGGTAT
TCCTTGTGGGGAGTCTTGTGTCTTTATTCCGTGTATCTCG
TCGGTCGTCGGCTGTTCTTGTAAGAGCAAAGTTTGCTATA
ATAATCATGTCATTGCCGCTGAAGCAAACTCGGTAGATGA
TCATCATCTCTTATGTCAATCTCATGATGACTGTATCAAA
AAAGGAACTGGAAATTTCTGTGCTCCGTTTCTTGATCATG
CTGTTCAATATGGGTGGTGCTTCCGTGCGGAATCTGAAGG
ATATTTATTAAAAGACTTCCTGAAAATGCCTAAAGCACTT
ACCAACTGAAAGGGGTCCTGAATAATGTATCTAGAACTAC
TTTAAATAAAAGCATGCATCTAGTATCTTGAGTAAAAGAA
CGAGTGCTTGCCTTGTAGTGAATAAACATTCACCAAAATA
ACATATATCCTTTTGGAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MAYVRLACLAVIFFFAASVMFTVEAGIPCGESCVFIPCIS
SVVGCSCKSKVCYNNHVIAAEANSVDDHHLLCQSHDDCIK
KGTGNFCAPFLDHAVQYGWCFRAESEGYLLKDFLKMPKAL
TN
Organism Clitoria ternatea L

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Proteins Encoded cliotide T8 precursor
Links