Clitoria ternatea cyclotide precursor cter A mRNA, complete cds(153) Nucleic Acid Card

General Information
Name Clitoria ternatea cyclotide precursor cter A mRNA, complete cds
Sequence ATGGCTTCCCTTCGCATTGCTCCTTTCGCTCTCTTCCTTT
TCCTTGCTGCTTCGGTTATGTTTGCGGTCGAGAAGACTGA
AGCAGGTGTCATTCCTTGTGGAGAATCTTGTGTATTTATT
CCATGTATATCAACAGTTATTGGTTGTTCTTGTAAGAACA
AAGTTTGCTATCGAAACCATATCATTGCAGCTGAGGCAAA
GACAATGGATGAGCATATTCTCTTATGTCAATCTCATGAA
GATTGTATCGCTAAAGGAACTGGAAACTTTTGTGCTCCTT
TCCCTGATCAAGATATTAAATATGGTTGGTGTTTTCGTGC
TGAGTCTGAGGGATTCATGTTGAAAGACCACTTAAAGATG
TCTATCACCAACTGAAAATAGTCACACATGCATAATGAAT
CTACTACTATAAAAAAAATACATGATGCATGTACTATCTT
AAATAAATGGTCGTTTTAGTTTCAAAAAAAAAAAAAAAAA
AAAAAA
Notes
Sequence translation MASLRIAPFALFLFLAASVMFAVEKTEAGVIPCGESCVFI
PCISTVIGCSCKNKVCYRNHIIAAEAKTMDEHILLCQSHE
DCIAKGTGNFCAPFPDQDIKYGWCFRAESEGFMLKDHLKM
SITN
Organism Clitoria ternatea L

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Proteins Encoded Cter A precursor
Links