Hedyotis biflora hedyotide B1 (hB1) mRNA, complete cds(151) Nucleic Acid Card

General Information
Name Hedyotis biflora hedyotide B1 (hB1) mRNA, complete cds
Sequence ATGGCTCATTTCATCAAATATCTTATCATGTTCTTGGTTA
TTGCAGCATGCGTTGGTGTTTTGGAAGTTGAGTCTGCTGA
AGCCGACCTGACCGCCCTCGGCGTAAGAAAGATGCTTGAT
CCACCAACTGAAGTAAGCATTTCTTTAGCCACAGAAATCC
AGTTCAAGAAAGAGTTGTTGGGTAGACTCAAAGGAACTCG
ATGCGGTGAGACTTGCTTCGTTTTACCATGCTGGTCCGCC
AAGTTCGGCTGCTACTGCCAAAAGGGTTTTTGTTACAGAA
ACGAATTAACACCAACTGCTGCTGCTGCATCTGAGAGCGA
ATAA
Notes
Sequence translation MAHFIKYLIMFLVIAACVGVLEVESAEADLTALGVRKMLD
PPTEVSISLATEIQFKKELLGRLKGTRCGETCFVLPCWSA
KFGCYCQKGFCYRNELTPTAAAASESE
Organism Hedyotis biflora

References
Nguyen,G.K., Zhang,S., Wang,W., Wong,C.T., Nguyen,N.T. and Tam,J.P. (2011) Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry. J. Biol. Chem. 286:44833-44844

Cross-references
Proteins Encoded hedyotide B1 precursor
Links