Hedyotis biflora hedyotide B2 (hB2) mRNA, complete cds(150) Nucleic Acid Card

General Information
Name Hedyotis biflora hedyotide B2 (hB2) mRNA, complete cds
Sequence ATGGCTCATTTCATCAAATATCTTATCATGTTCTTGGTTA
TTGCAGCATGCGTTGGTGTTTTGGAAGTTGAGTCTGCTGA
AGCCGACCTGACCGCCCTCGGCATAAGAAAGATGCTTGAT
CCACCAACTGAAGTTGGTATTTCTTTTGCCGCAGAAATCC
AGTTCAAGAAAGAGTTGTTGGGTAGACTCAAAGGAATTCA
ATGCGGCGAGAGTTGCGTTTGGATACCATGCATTAGCTCG
GCGTGGGGCTGCTCGTGCAAAAACAAAATATGTTCCAGTT
AACCCCAACTGTTGCTGCTGCATCTGAGAGCGAATAA
Notes
Sequence translation MAHFIKYLIMFLVIAACVGVLEVESAEADLTALGIRKMLD
PPTEVGISFAAEIQFKKELLGRLKGIQCGESCVWIPCISS
AWGCSCKNKICSS
Organism Hedyotis biflora

References
Nguyen,G.K., Zhang,S., Wang,W., Wong,C.T., Nguyen,N.T. and Tam,J.P. (2011) Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry. J. Biol. Chem. 286:44833-44844

Cross-references
Proteins Encoded hedyotide B2 precursor
Links