E.faecalis plasmid AS48 gene(15) Nucleic Acid Card

General Information
Name E.faecalis plasmid AS48 gene
Sequence CTAAGAAGTGTCTAGTTATTTTTTCTTGGGTTATTTACAG
GAATAGATATGTTATTGCTTGCATCAAAATAAACTACATG
GGTATAATAGCAATGAAATGCATTTCAAAAATATTTTGAG
GAGGAGTATCATGGTTAAAGAAAATAAATTTTCTAAGATT
TTTATTTTAATGGCTTTGAGTTTTTTGGGGTTAGCCTTGT
TTAGTGCAAGTCTTCAGTTTTTGCCCATTGCACATATGGC
TAAAGAGTTCGGTATACCAGCAGCAGTTGCAGGAACTGTG
CTTAATGTAGTTGAAGCTGGTGGATGGGTCACTACTATTG
TATCAATTCTTACTGCTGTAGGTAGCGGAGGTCTTTCTTT
ACTCGCTGCAGCAGGAAGAGAGTCAATTAAAGCATACCTT
AAGAAAGAAATTAAGAAAAAAGGAAAAAGAGCAGTTATTG
CTTGGTAATTTAACAATATGATAAAAAAACAGGATATTTT
CTAGAGATATTCTGTTTTTTAATTAAAAAAGGGGGGCGCT
CATGAATCTCTTTGGAATTC
Notes
Sequence translation MVKENKFSKIFILMALSFLGLALFSASLQFLPIAHMAKEF
GIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAA
AGRESIKAYLKKEIKKKGKRAVIAW
Organism Enterococcus faecalis

References
Martinez-Bueno M, Maqueda M, Galvez A, Samyn B, Van Beeumen J, Coyette J, Valdivia E (1994) Determination of the gene sequence and the molecular structure of the enterococcal peptide antibiotic AS-48. J Bacteriol 176:6334-9

Cross-references
Proteins Encoded Ent AS-48
E.faecalis AS48 precursor protein
Links