Hedyotis biflora hedyotide B2 (hB2) gene, complete cds(149) Nucleic Acid Card

General Information
Name Hedyotis biflora hedyotide B2 (hB2) gene, complete cds
Sequence ATGGCTCATTTCATCAAATATCTTATCATGTTCTTGGTTA
TTGCAGCATGTAAGTAAACTTTCCATCACATCTCTATCTC
TTGAAAAGTAACTTTTGGCATAATCAATATGAAGTAACAA
TTTTGTTTTTTTGGTGGGTAAATATTCATGTAGGCGTTGG
TGTTTTGGAAGTTGAGTCTGCTGAAGCCGACCTGACCGCC
CTCGGCATAAGAAAGATGCTTGATCCACCAACTGAAGTTG
GTATTTCTTTTGCCGCAGAAATCCAGTTCAAGAAAGAGTT
GTTGGGTAGACTCAAAGGAATTCAATGCGGCGAGAGTTGC
GTTTGGATACCATGCATTAGCTCGGCGTGGGGCTGCTCGT
GCAAAAACAAAATATGTTCCAGTTAACCCCAACTGTTGCT
GCTGCATCTGAGAGCGAATAA
Notes CDS: 1-49,154-386 Intron: 50-153 (intron is in the ER signal)
Sequence translation MAHFIKYLIMFLVIAACVGVLEVESAEADLTALGIRKMLD
PPTEVGISFAAEIQFKKELLGRLKGIQCGESCVWIPCISS
AWGCSCKNKICSS
Organism Hedyotis biflora

References
Nguyen,G.K., Zhang,S., Wang,W., Wong,C.T., Nguyen,N.T. and Tam,J.P. (2011) Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry. J. Biol. Chem. 286:44833-44844

Cross-references
Proteins Encoded hedyotide B2 precursor
Links