V03-3 mRNA, complete cds(146) Nucleic Acid Card

General Information
Name V03-3 mRNA, complete cds
Sequence AGAAGCAAGAACTCGCAAAAGCAACTGAATTACTCTTTAA
GTTTTGATTCCGGAAGCAGAGATCTTTCCAGATATGAAGA
ATATGGAAACAACCAGCGCAGGTAATGATGATTGGTTGGA
GGGTTATGTTGCTGCCAGTATTGTTGATGATAACATTGCG
AATGATGTCAATCTCGATCTTCTTACTGTCCCTCAATATG
GGAGAAATATTGATCAAACCGGTTAAATGCAAGCAATATT
ACTCTTTTGTGTTATGCTTATTTAAATAAAAAGATGGGTA
CTGTTATTACCTATCAATGTGTGAGTGTCTGTTTACTCAG
TTCTACTTAATAAGATATCTTGATATGTATAAGAGTTTTT
CTTTATTTACTATCTTTGTGTGGTGTCTTCCTGGAAAAGG
TAATTACTGAATAAAATTGTTGCGTCTGTTATAAAGTGTT
GATTAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MKNMETTSAGNDDWLEGYVAASIVDDNIANDVNLDLLTVP
QYGRNIDQTG
Organism Citrus sinensis

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90
Mozoruk J, Hunnicutt LE, Hunter WB, Bausher MG (2008) CsV03-3 is a member of a novel gene family from citrus that encodes a protein with DNA binding activity and whose expression is responsive to defense signals and abiotic stress. J Plant Physiol 165:531-543

Cross-references
Proteins Encoded V03-3 precursor
Links