cDNA clone a_2_H09, mRNA sequence(144) Nucleic Acid Card

General Information
Name cDNA clone a_2_H09, mRNA sequence
Sequence ACTTATTTTTTAATATAGTGCACTCGAAGCTAGCAAATAT
CTTTTCTGACTTGAAGAATATGAAAACTCTTCCTGGCGCA
GGTATGAGCGATCCGTCAGAAGGTTACTTACTCCCCCCTT
CCAGTATTGCTGATGATGATGTTGGGAATGACAATCTTGA
TCTTATTGTTATTCCTCAATATGGGAGAAATCCTGATTAT
TATGGGTAAGTGTCTGCAATCTGGATGATGATATATATAA
TTAAATAAAAAGATGGGTACAAAGTCATTAACTTCTGGCG
CCCAAATCTCCTCATACTTGCATGCAATGAGCATTGCGCT
GATGCCGACTAACTGAAGTTCCTTCCGCTGAATAGTCTCC
TTTGAAAGGAAACGATCAACGATATGAACGGTAAGATAGA
GGGTTTCTGGCATTAGTTCAAATTTTCGATGAACTTCAGT
TAACCAGTCCACCAGAATTGATCTCATTTTTGCATTAATT
TCTGGTTGTGCATCCATGTAGTCGTGT
Notes
Sequence translation MKTLPGAGMSDPSEGYLLPPSSIADDDVGNDNLDLIVIPQ
YGRNPDYYG
Organism Citrus natsudaidai

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded a_2_H09 precursor
Links