CA26-C1-002-078-G08-CT.F (EST)(143) Nucleic Acid Card

General Information
Name CA26-C1-002-078-G08-CT.F (EST)
Sequence CCACGCGTCCGGCACTCGAAGCTAGCAAAGATCTTTTCTG
ACTTGAAGAATATGAAAACTCTTGCTGGCGCAGGTATGAG
CGATCCGTCAGAAGGTTTGGTACTCCCTTCCAGTATTGCT
GATGATGATGTTGGAAATGACAATCTTGATCTTATTGTTA
TTCCTCAATATGGGAGAAATCCTGATTATTATGGGTAAGT
GTCTGCAATCTGGATGATGATATATGTAATTAAATAAAAG
GATGGGTACAGTTATTACCTATCAATCATAAGAGTGTCAA
TTTAGTTCAGTTCACTAATAAAAATCTCTTATACAAGAGA
TTATCTTTGTTTGCGTTCATGTACTTTGTCTTCTTTAATT
AATAAATAAAATTATTGTGTATCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAG
Notes
Sequence translation MKTLAGAGMSDPSEGLVLPSSIADDDVGNDNLDLIVIPQY
GRNPDYYG
Organism Citrus aurantium

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded CA26-C1-002-078-G08-CT.F precursor
Links