cDNA clone Dc004 (EST)(141) Nucleic Acid Card

General Information
Name cDNA clone Dc004 (EST)
Sequence AAAAAAAAAACATTAAAACAAATAACTAATACACACTATT
ACTCCTATCTACTTGCGAAGATGTCTCCAAATTCTACTCG
CGACCTATTGAAGCCACTCGGCTACAAAGATTGCTGCGTT
CAGGCAAAGGATTTGGAAAATGCTGCAGTTCCAGTGTAAC
ATATATTCATTGCACTTTCGTGGCCTTTAGATATCAACGT
TTCCAACCAACCATGATGTCTCTGTGTCTTTAGTTGGTAG
CTAATCGTTCCACGTCCAATGTCCGTTTTTTTTATATATA
TAAATGTTTTTATGTATTCCGACTTTCAGGTTGAACAATG
T
Notes
Sequence translation MSPNSTRDLLKPLGYKDCCVQAKDLENAAVPV
Organism Dianthus caryophyllus

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded Dc004 precursor
Links