IAA16-like EST(140) Nucleic Acid Card

General Information
Name IAA16-like EST
Sequence ACATCAACATTTGTTTAGATTTGGGAAATTAATATTTAAA
GGCCACAATGGTGCAATGCTTGCATGTTACACCGGAACTG
AAGCGTTTTCAGCATCCTTTGCCTGAAAACCATAAAATGG
AATGGGGCCTTGTGGCTTCAATATGTCGCGAGTTGAATTT
GGAGACATTTTCACAAGCACTAGTGTTTTGTTTGGACTTA
TAATATATATATATGTGAT
Notes
Sequence translation MSPNSTRDILKPQGPIPFYGFQAKDAENASVPV
Organism Dianthus caryophyllus

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded IAA16-like precursor
Links