htf-1 precursor(14) Nucleic Acid Card

General Information
Name htf-1 precursor
Sequence GTCATGGACTAATTCTTGGTGTTCTGGGAAGTTGAGGTGT
GCTGCATATCCGACCATGACTGTTCGTCGACATAATAAAG
ATTCTTGATCCACCAACTGAAATCAACATTTCTTTAGCCG
CCGAAATCCAATTCAAAAAGGAGTTGATGGGTAGACTTAA
AGGAATTCCATGCGGTGACAGTTGCCATTACATACCATGC
GTAACATCCACGATCGGGTGCTCGTGCACAAACGGATCTT
GTATGAGAAATGAATTAACCCCTGCTGCTACATATGA
Notes
Sequence translation HGLILGVLGS*GVLHIRP*LFVDIIKILDPPTEINISLAA
EIQFKKELMGRLKGIPCGDSCHYIPCVTSTIGCSCNGSCM
RNELTPAATY
Organism Hedyotis terminalis

References
Levesque MP, Twigg RW, Motley T, Katari MS, Dedhia NN, O'Shaughnessy AL, Balija V, Martienssen RA, McCombie RW, Benfey P, Stevenson D (0) . :0-0

Cross-references
Proteins Encoded htf-1
Links