putative presegetalin F1c mRNA, complete cds(134) Nucleic Acid Card

General Information
Name putative presegetalin F1c mRNA, complete cds
Sequence GGAAACCACAAATTAAAGCACAAACATAATCACCGATAAT
TTTACAAACATACATATTATCGTTCAATTCTTATCGTACG
TTATTATTATTGCAAGAATGGCCACCTCTTTCCAATTTGA
TGGTCTTAAGCCATCTTTTTCTGCTTCGTACAGCAGCAAG
CCCATTCAAACTCAGGTTTCAAACGGCATGGACAATGCTT
CTGCCCCAGTGTAAACGCATCTAGCTACCGTCGGAAATAA
ATGGCCTTTACTAGCTATAGACTCGACGTCAAGTTAATAA
ATCGTATACGATGGTGCCTCATGTATCTCACTATTGTACT
CGATCATCAACTCATCGTCATGTCATTTGTGTGTAATCTT
TATAATAAAATAAATAAATAAATAAACAAAGGCTTTATTT
CT
Notes
Sequence translation MATSFQFDGLKPSFSASYSSKPIQTQVSNGMDNASAPV
Organism Vaccaria hispanica

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded presegetalin F1
Links