putative presegetalin D3b mRNA, complete cd(131) Nucleic Acid Card

General Information
Name putative presegetalin D3b mRNA, complete cd
Sequence GGACACACAAAAAACATTCAAACAAATCATTTAATCTCTA
ACTTTACAAGTCCAATACTTTATTTGTGAAAATGTCTCCA
ATCCTCGCCCACGACGTAGTCAAGCCCCAAGGCCTAAGTT
TCGCTTTTCCGGCAAAAGATGCTGAAAATGCTTCATCCCC
GGTGTAAACTTATGCCTGCAATGCGCTTCTGCGGCCTTTA
GATACGATGTCTCCAGCCAAACCAAACCATAATGTTATGT
TCGACGTCGTGTTTCTTACTTTTTTAGTTTTATTTTACGT
TTATCGGTTCGACTTTTAAGTTGAAGAATAATGTATTTTG
TTTATGGTTTGTAATAAAATTTAAAGGCCGATTTAGTGTA
CGT
Notes
Sequence translation MSPILAHDVVKPQGLSFAFPAKDAENASSPV
Organism Vaccaria hispanica

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded presegetalin D3
Links