hcf-1 precursor-3(13) Nucleic Acid Card

General Information
Name hcf-1 precursor-3
Sequence GAAATCCAATTCAAAAAAGAGTTGATGGGTAGACTTAAAG
GAATTCCATGCGGTGAGAGTTGCCATTACATACCATGCGT
AACATCCGCGATCGGCTGCTCGTGCAGAAACAGATCTTGT
ATGAGAAATGAATTAACCCCTGCTGCTCCATTGAAACAGA
CTGAAACGAGCCCAAGGAACAGAAATCTATGATGTTGCTG
TTGGGATTATGTTTTCCCAGTAACCCAAATTCTGTGTGTG
TTTGTGTGGGTGTTGCATTTTTTTCCTTTTTCCCTTTCCA
TCTTCCCAAAGAGATCTTTTGACTCCCCTTGTTGTGCTTC
TATTTTGTGTATCCTTTACCCTTTCGGTGTTGTTGTTCCC
TTGTTTGTTCCCTAAAGTGGAATAAATTTGTTATTGTTGT
AATCTTGTATCGTCTTCTATTTTCAATGTAAGTTAGTCGA
TTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA
Notes
Sequence translation EIQFKKELMGRLKGIPCGESCHYIPCVTSAIGCSCRNRSC
MRNELTPAAPYETD*NEPKEQKSMMLLLGLCFPSNP NSV
CVCVGVAFFSFFPFHLPKEIF*SPLVVLLFCVSFTLSVLL
FPCLFPKVE*ICYCCNLVSSSIFNVS*SIKKKKKKKKKKK
KX
Organism Hedyotis centranthoides

References
Levesque MP, Twigg RW, Motley T, Katari MS, Dedhia NN, O'Shaughnessy AL, Balija V, Martienssen RA, McCombie RW, Benfey P, Stevenson D (0) Unpublished. :0-0

Cross-references
Proteins Encoded hcf-1
Links