putative presegetalin D1 mRNA, complete cds(128) Nucleic Acid Card

General Information
Name putative presegetalin D1 mRNA, complete cds
Sequence GACACACAAAATAAATTCATACAAATCATTTATTTAGTCT
CTAACTTACAAACTCCAATACTTCATTTGTGAAAATGTCT
CCAATTTTTGCCCACGACGTAGTCAACCCCCAAGGCCTAA
GTTTCGCTTTTCCGGCAAAAGATGCTGAAAATGCTTCATC
CCCGGTGTAAACTTATGTACACAATGCGCTTCTTCGGCCT
TTAGATACGATGTTTCCAACCAAAATAAACCATAATGTTA
TGTCGAGTGTCATGTTTCTTATTTCTGTAATTTTATTTCT
GTATATTGTTTCGATTTTTAAATTGAAACAATAAACTATG
TTAACTGGTTTGTAATAAAATCTAAAAGGCCGTTCTAGTA
C
Notes
Sequence translation MSPIFAHDVVNPQGLSFAFPAKDAENASSPV
Organism Vaccaria hispanica

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded presegetalin D1
Links