presegetalin A1 mRNA, complete cds(126) Nucleic Acid Card

General Information
Name presegetalin A1 mRNA, complete cds
Sequence GACACAAAAAACATTCAAACAAATCATTTAATCTCTAACT
TTACAAGTCCAATACTTTATTTGTGAAAATGTCTCCAATC
CTCGCCCACGACGTAGTCAAGCCCCAAGGTGTCCCAGTTT
GGGCTTTTCAGGCAAAAGATGTTGAAAATGCTTCAGCCCC
TGTGTAAATTAATGTACACAATGCGCTTCTTCGGCCTTTA
GATACGATGTTTCCAACCAAAATAAACCATAATGTTATGT
CGAGTGTCATGTTTCTTATTTCTGTAATTTTATTTCTGTA
TATTGTTTCGATTTTTAAATTGAAACAATAAACTATGTTA
ACTGGTTTGTAATAAAATCTAAAAGGCCGTTCTAGTGTAA
ATTTAAGCATTCTCCTGTCGTTCATTTCTCCTTAGACACA
TTAAACCATACTAAGATAATATAATTTTGAACTCAAAATA
TTAT
Notes
Sequence translation MSPILAHDVVKPQGVPVWAFQAKDVENASAPV
Organism Vaccaria hispanica

References
Condie JA, Nowak G, Reed DW, Balsevich JJ, Reaney MJ, Arnison PG, Covello PS (2011) The biosynthesis of Caryophyllaceae-like cyclic peptides in Saponaria vaccaria L. from DNA-encoded precursors. Plant J 67:682-90

Cross-references
Proteins Encoded presegetalin A1
Links