Clitoria ternatea cyclotide M precursor, mRNA, complete cds.(125) Nucleic Acid Card

General Information
Name Clitoria ternatea cyclotide M precursor, mRNA, complete cds.
Sequence ATGGCTTACGTTAGACTTACTTCTCTTGCCGTTCTCTTCT
TCCTTGCTGCTTCCGTTATGAAGACAGAAGGAGGACTTCC
TACATGCGGAGAAACTTGTACCCTGGGGACATGTTATGTG
CCAGATTGTTCATGTTCATGGCCAATTTGCATGAAAAATC
ATATCATTGCAGCTAATGCAAAAACAGTGAATGAACATCG
TCTCTTATGTACATCTCATGAAGACTGTTTTAAGAAAGGC
ACTGGAAACTATTGTGCTTCTTTTCCCGATTCTAACATCC
ATTTTGGTTGGTGTTTCCATGCTGAATCTGAAGGATATTT
GTTGAAAGACTTTATGAATATGTCAAAGGATGACTTAAAG
ATGCCTTTGGAAAGTACCAACTAA
Notes
Sequence translation MAYVRLTSLAVLFFLAASVMKTEGGLPTCGETCTLGTCYV
PDCSCSWPICMKNHIIAANAKTVNEHRLLCTSHEDCFKKG
TGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKDDLK
MPLESTN
Organism Clitoria ternatea L

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132

Cross-references
Proteins Encoded Cter M precursor
Links