Helianthus annuus preproalbumin PawS2 (PawS2) mRNA, complete cds(122) Nucleic Acid Card

General Information
Name Helianthus annuus preproalbumin PawS2 (PawS2) mRNA, complete cds
Sequence GAAGAAGAAAACGAAAACATCCCAAAATGGCAAACCTTGT
ACTTGCTGCACTCACCATGGCGGCCTTCCTAGCATTTGTT
TTCCGGACGGCCTATGCCGGTTGTATCGAGGGGTCTCCGG
TTTGTTTTCCCGACGGTCTGGACAACCCCAGAGGCTGTCA
GATTCCAATCCAGAAGCTGAACCACTGCCAGATGCACCTC
GCCTCTTTCGATTACAAGCTCAGGATGGCAGTGGAGAACC
CGAAACAACAACACCTTAATCTGTGCTGCAACCAGCTACA
AGAAGTGGAGAAACAGTGTCAGTGTGAGGCGATCAAACAG
GTAGTGGAACAAGCTCAAAAGCATCTGCAGCAAGGTCAAG
GTGGACAACAGCAGGTGCAACAGATGGTGAAGAAGGCTCA
GATGCTCCCCAACCAATGCAACTTGCAATGCTCAATCTGA
TCAGTCCCAAGCATGCACTAGTGTTTGTTTTGAGTTTGAA
TGTATGCATGCATGCATGTAATATATAATAACAATGCATG
ATCACTCTTTGGCTCCAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
Notes
Sequence translation MANLVLAALTMAAFLAFVFRTAYAGCIEGSPVCFPDGLDN
PRGCQIPIQKLNHCQMHLASFDYKLRMAVENPKQQHLNLC
CNQLQEVEKQCQCEAIKQVVEQAQKHLQQGQGGQQQVQQM
VKKAQMLPNQCNLQCSI
Organism Helianthus annus

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Proteins Encoded PawS2 - annuus
Links