Helianthus tuberosus clone HT__Ef0001C13 preproalbumin (PawS1) mRNA, complete cds(121) Nucleic Acid Card

General Information
Name Helianthus tuberosus clone HT__Ef0001C13 preproalbumin (PawS1) mRNA, complete cds
Sequence GACACAAAAGACAACCACAATGGCAAAACTTATAACACTT
GTTGTATTCGCTATGTTAGCATTTGTTGAGGTTTCTGTTT
CTGGTTACAAAACCTCTATCTCCACCATCACCATAGAGGA
CAATGGCAGGTGTACTAAGTCGATTCCCCCGATTTGTTTT
CCCGATGGCCTGGACAACCCCATAGAGGACAATAGCTTTA
GATTTTACCCCGATGGCCTGGACAACCCCGGAGGCTGCCA
GATTCGGATCCAGCAGCTGAACCACTGCCAGATGCACCTC
ACCTCTTTCGATTACAAGCTAAGGATGGCGGTGGAGAACC
CGAAACAACAACACCTTAATCTGTGCTGCAACCAGCTACA
AGAAGTGGAGAAGCAGTGTCAGTGTGAGGCGATCAAACAG
GTGGTGGAACAAGCTCAAAAGCAGCTGCAGCAAGGTCAAG
GTGGACAGCAGCAGGTGCAACAGATGGTGAAGAAGGCTCA
GATGCTCCCCAACCAATGCAACTTGCAATGCTCGATCTGA
TCAGTCCCAAGCATGCACTAGTGTTTGTTTGAGTTTGAAT
GTATGCATGCATGTAATATATAATAATGCATGATCGCTCT
TTGGCTTGAGATGGGAAGCCGCTTTTCTCTGCATAATAAA
AACACACACTCGTGTGAATGTGTAGC
Notes
Sequence translation MAKLITLVVFAMLAFVEVSVSGYKTSISTITIEDNGRCTK
SIPPICFPDGLDNPIEDNSFRFYPDGLDNPGGCQIRIQQL
NHCQMHLTSFDYKLRMAVENPKQQHLNLCCNQLQEVEKQC
QCEAIKQVVEQAQKQLQQGQGGQQQVQQMVKKAQMLPNQC
NLQCSI
Organism Helianthus tuberosus

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Proteins Encoded PawS1 - tuberosus
Links