Helianthus exilis clone HE_AEc0024A09 preproalbumin (PawS1) mRNA, complete cds(120) Nucleic Acid Card

General Information
Name Helianthus exilis clone HE_AEc0024A09 preproalbumin (PawS1) mRNA, complete cds
Sequence GACAATGGCAAAACTTACATTTGTTGTACTCGCTATCTTA
GCATTTGTTCAGGTTTCTGTTTCTGGTTACAAAACATCTA
TCTCCACCATCACCACCATAGAGGACAATGGCAGGTGTAC
CAAGTCGATTCCCCCGATTTGTTTTCCCGATGGCCTGGAC
AACCCCCGAGGCTGCCAGATTCGGATCCAGCAGCTGAACC
ACTGCCAGATGCACCTCACCTCTTTCGATTACAAGCTCAG
GATGGCGGTGGAGAACCCGAAACAACAACAACAACACCTT
AATCTGTGCTGCAACCAGCTACAACAAGTGGAGAAGCAGT
GTCAATGTGAGGCGATCAAACAGGTGGTGGAACAAGCCCA
AAAGCAGCTGCAGCAAGGTCAAGGTGGACAGCAGCAGGTG
CAACAGATGGTGAAGAAGGCTCAGATGCTCCCCAACCAAT
GCAACTTGCAATGCTCGATCTGATCAGTCACAAGCATGCA
TTAGTGTTTGTTTGAGTTTGAATGTATTCATGCATGCATG
TAATATATAATAATAATGCATGATCGCTCTTTGGCTTGAG
ATGAAAGCCGCTTTTCTCTGCATAATAAAAACACACACTC
GTGTGAATGTGTATCAACCGTA
Notes
Sequence translation MAKLTFVVLAILAFVQVSVSGYKTSISTITTIEDNGRCTK
SIPPICFPDGLDNPRGCQIRIQQLNHCQMHLTSFDYKLRM
AVENPKQQQQHLNLCCNQLQQVEKQCQCEAIKQVVEQAQK
QLQQGQGGQQQVQQMVKKAQMLPNQCNLQCSI
Organism Helianthus exilis

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Proteins Encoded PawS1 - exilis
Links