hcf-1 (variant) precursor-2(12) Nucleic Acid Card

General Information
Name hcf-1 (variant) precursor-2
Sequence CTCTCTTTCTTTGTCTTTGATCAGTTTAAAGTCTCTGATG
AAGAACAACTTTGATTTGATCTTTAAGAAGGAAAATTTCG
ATGGCTAGTTTCATCAACTATCTCATCATGTTCTTGCTTG
GTGCAGCATTTCTTGGTGTTCTGGAAGTTGAG TGTGCTG
AAGCCGACCAGACTGTCGTCGACATAAGAAAGATTCTTGA
TCCACCAACTGAAATCGACATTTCTTTAGCCGCCGAAATC
CAATTCAAAAAAGAGTTGATGGGTAGACTTAAAGGAATTC
CATGCGGTGAGAGTTGCCATTACATACCATGCGTAACATC
CGCGATCGGCTGCTCGTGCAGAAACAGATCTTGTATGAGA
AATGAATTAACCCCTGCTGCTACATATGAAACAGACTGAA
ACGAGACCAAGGAACAGAAATCTATGATGTTGCTGTTGGG
ATTATGTTTTCACAGTAACCCAAATTCTGTGTGTGTTTGT
GTGTGTGTTGCATTTTTTTCCTTTTTCCCTTTCCATCTTC
ACAAAGAGATCTTTTGATCTCCACTTGTTGTGCTTCTATT
TTGTGTATCCTTTACCCTTTCGGTGTTGTTGTTCACTTGT
TTGTTGCCT AAAGTGGAATAAATTTGTTATTGTTGTAAA
AAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation LFLCL*SV*SL**RTTLI*SLRRKISMASFINYLIMFLLG
AAFLGVLEVECAEADQTVVDIRKILDPPTEIDISLAAEIQ
FKKELMGRLKGIPCGESCHYIPCVTSAIGCSCRNRSCMRN
ELTPAATYETD*NETKEQKSMMLLLGLCFHSNPNSVCVCV
CVAFFSFFPFHLHKEIF*SPLVVLLFCVSFTLSVLLFTCL
LPKVE*ICYCCKKKKKKKK
Organism Hedyotis centranthoides

References
Levesque MP, Twigg RW, Motley T, Katari MS, Dedhia NN, O'Shaughnessy AL, Balija V, Martienssen RA, McCombie RW, Benfey P, Stevenson D (0) Unpublished. :0-0

Cross-references
Proteins Encoded hcf-1 precursor protein
hcf-1 variant
Links