Helianthus argophyllus clone HA_BEc00001N04 preproalbumin (PawS2) mRNA, complete cds(119) Nucleic Acid Card

General Information
Name Helianthus argophyllus clone HA_BEc00001N04 preproalbumin (PawS2) mRNA, complete cds
Sequence GAAACGAAAACATTCCAAAATGGCAAACCTTGTACTTGCT
GCACTCACCATGGCGGCCTTCCTAGCATTTGTTTTCCGGA
CGGCCTATGGCGGTTGTATCGAGGGGTCTCCGGTTTGTTT
TCCCGACGGTCTGGACAACCCCAGAGGCTGTCAGATTCCG
ATCCAGAAGCTGAACCACTGCCAGATGCACCTCGCCTCTT
TCGATTACAAGCTCAGGATGGCGGTGGAGAACCCGAAACA
ACAACACCTTAATCTGTGCTGCAACCAGCTACAAGAAGTG
GAGAAGCAGTGTCAGTGTGAGGCGATCAAACAGGTAATGG
AACAAGCTCAAAAGCAGCTGCAGCAAGGTCAAGGTGGACA
ACAGCAGGTGCAACAGATGGTGAAGAAGGCTCTGATGCTC
CCGAACCAATGCAACTTGCAATGCTCAATCTGATCAGTCC
CAAGCATGCACTAGTGTTTGTTTTGAGTTTGAATGTATGC
ATGCATGCATGTGATATATAATAACAATGCATGATCACTC
TTTGGCTTGAGATGGGAGTTTCTCTGTATAATAAAAACAC
ATACTTGTGTGACTGTGATTAAC
Notes
Sequence translation MANLVLAALTMAAFLAFVFRTAYGGCIEGSPVCFPDGLDN
PRGCQIPIQKLNHCQMHLASFDYKLRMAVENPKQQHLNLC
CNQLQEVEKQCQCEAIKQVMEQAQKQLQQGQGGQQQVQQM
VKKALMLPNQCNLQCSI
Organism Helianthus argophyllus

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Proteins Encoded PawS2 - argophyllus
Links