BTD-a precursor(115) Nucleic Acid Card

General Information
Name BTD-a precursor
Sequence AGACCTGGGACAGAGGACTGCTGTCTGCACTCTCTCTTCA
CTCTGCCTAACTTGACGATCTGTCACTCCAGCCATGAGGA
CCTTCGCCCTCCTCACCGCCATGCTTCTCCTGGTGGCCCT
GCATGCTCAGGCAGAGGCACGTCAGGCAAGAGCTGATGAA
GCTGCTGCCCAGCAGCAGCCTGGAGCAGATGATCAGGGAA
TGGCTCATTCCTTTACATGGCCTGAAAACGCCGCTCTTCC
GCTTTCAGAGTCAGCGAAAGGCTTGAGGTGCGTTTGCACA
CGAGGATTCTGCCGTTTGTTATAATGTCACCTTGGGTCCT
GCGCCTTTCATGGTTGACTCCACCGGATCTGCTGCCGCTG
AGCTTCCAGAATCAAGAAAAATACGCTCAGAAGTTACTTT
GAGAGTTACAAGAAATTCTTGCTACTGCTGTACCTTCTCC
TCAGTTTCCTTTTCTCATCCCAAATAAATACCTTATCGCA
GAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGADD
QGMAHSFTWPENAALPLSESAKGLRCVCTRGFCRLL
Organism Papio anubis

References
Garcia AE, Osapay G, Tran PA, Yuan J, Selsted ME (2008) Isolation, synthesis, and antimicrobial activities of naturally occurring theta-defensin isoforms from baboon leukocytes. Infect Immun 76:5853-5891

Cross-references
Proteins Encoded BTD-a precursor
Links