LycQ [Lactocyclicin Q](114) Nucleic Acid Card

General Information
Name LycQ [Lactocyclicin Q]
Sequence GTAATTAATAGCTTATTTTACTGAAAAAGTAAAACTTAGA
GAGGAATAAAACATATGAAATTAATTGATCATTTAGGTGC
TCCAAGATGGGCCGTTGATACTATTTTAGGTGCAATCGCA
GTTGGGAACTTAGCAAGTTGGGTTCTAGCGCTTGTCCCTG
GTCCAGGGTGGGCAGTAAAAGCTGGTTTAGCAACTGCTGC
TGCCATCGTTAAACATCAAGGTAAAGCTGCCGCTGCTGCT
TGGTAATAATTTTCTATTCTAGTATCGCTTTAGGAGTAAT
CCATAGCGATATTTATATTT
Notes
Sequence translation MKLIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWA
VKAGLATAAAIVKHQGKAAA AAW
Organism Lactococcus sp. QU 12

References
Sawa N, Zendo T, Kiyofuji J, Fujita K, Himeno K, Nakayama J, Sonomoto K (2009) Identification and characterization of lactocyclicin Q, a novel cyclic bacteriocin produced by Lactococcus sp. strain QU 12. Appl Environ Microbiol 75:1552-1558

Cross-references
Proteins Encoded Lactocyclicin Q precursor
Links