kalata B19 precursor [OaK5](112) Nucleic Acid Card

General Information
Name kalata B19 precursor [OaK5]
Sequence ATCGGCCGAGCTGGGGTGGAGCTTTTGAGCCAAATTGGCG
GACGACGAGACCACCTTGGCCACTGAAATCGCCGATAAGA
TGCTCCTGAAGAAGATGCTGTCCGGAGTGGACATGGGAAA
GGTGGCGAACAGGACCGCCTTGGTCAAAGAAATCGCGGAT
AAGATGTTCCTAAAGAAGATGCTGCAGCAGGCGGCTGCCG
GCGGAGGAGCTACTTCTGAGACCGCCGAGAAGATGCTCAA
AAGAGAGATGGAGAGCCGACTGACTGGGTTTCCATGTGGT
GAGAGCTGCGTTTATGTACCATGCCTCACCGCCGCGATTG
GCTGCTCATGCAGCAACAAGGTATGTTACAAAAACAATTT
ACCCCAAGCTGAAGCTGCTGCATAAACGAAGAACAATGAT
AATAGATGAGAAGCCAACCGATCGATCTACGAGATAGTAC
CTATATAGCTATATAGAATAATGTTGTTGGCTCGCTCCGA
ATCGTGCTTGTTTCTTCATGATGACATGAAGATGTGAATA
TACTTTGTGTATGCTTTTTTCTCCTTCAAATGCTGTACTG
TTGCTTGTTCAGCTTCTTGTTGCCCAATTGGAATAAATAT
ACATCACTAAAGTTGGGATTGTT
Notes
Sequence translation AKLADDETTLATEIADKMLLKKMLSGVDMGKVANRTALVK
EIADKMFLKKMLQQAAAGGGATSETAEKMLKREMESRLTG
FPCGESCVYVPCLTAAIGCSCSNKVCYKNNLPQAEAAA
Organism Oldenlandia affinis

References
Qin Q, McCallum EJ, Kaas Q, Suda J, Saska I, Craik DJ, Mylne JS. (2010) Identification of candidates for cyclotide biosynthesis and cyclisation by expressed sequence tag analysis of Oldenlandia affinis. BMC Genomics 11:111-0

Cross-references
Proteins Encoded Kalata B19 precursor
kalata B19
Links