hcf-1 precursor-1(11) Nucleic Acid Card

General Information
Name hcf-1 precursor-1
Sequence CGAAATCCAATTCAAAAAAGAGTTGATGGGTAGACTTAAA
GGAATTCCATGCGGTGAGAGTTGCCATTACATACCATGCG
TAACATCCGCGATCGGCTGCTCGTGCAGAAACAGATCTTG
TATGAGAAATGAATTAACCCCTGCTGCTACATATGAAACA
GACTGAAACGAGACCAAGGAACAGAAATCTATGATGTTGC
TGTTGGGATTATGTTTTCACAGTAACCCAAATTCTGTGTG
TGTTTGTGTGTGTGTTGCATTTTTTTCCTTTTTCCCTTTC
CATCTTCACAAAGAGATCTTTTGATCTCCACTTGTTGTGC
TTCTATTTTGTGTATCCTTTACCCTTTCGGTGTTGTTGTT
CACTTGTTTGTTGCCTAAAGTGGAATAAATTTGTTATTGT
TGTAATCTTGTATCGTCTTCTATTTTCAATGTAAGTTAGT
CGATTATATAAGCTCTTCTTAAAAAACTCCAAAAAAAAAA
AAAAAAAAAA
Notes
Sequence translation EIQFKKELMGRLKGIPCGESCHYIPCVTSAIGCSCRNRSC
MRNELTPAATYETD*NETKEQKSMMLLLGLCFHSNP NSV
CVCVCVAFFSFFPFHLHKEIF*SPLVVLLFCVSFTLSVLL
FTCLLPKVE*ICYCCNLVSSSIFNVS*SII*AL LKKLQK
KKKKK
Organism Hedyotis centranthoides

References
Levesque MP, Twigg RW, Motley T, Katari MS, Dedhia NN, O'Shaughnessy AL, Balija V, Martienssen RA, McCombie RW, Benfey P, Stevenson D (0) Unpublished. :0-0

Cross-references
Proteins Encoded hcf-1
Links