OaK8(109) Nucleic Acid Card

General Information
Name OaK8
Sequence GTGTTTTGGGAGTTGCGGCTTCTGGCCATGACAAGACCGC
ATTGGTCAATGAAATCACCGAAATGCTGGCTGGAGTGGAA
ACTTTTGAAGCCAAACTGGACAAGGCCGCCCTGGTCTCAG
AAATGGCCGATAAAGTGTTCTTGAGAAAGATGTTGTCAGG
AGTGGACATTGAAAAAGCGGACAAGAAAGCCTTGGTCAAA
GAAATCTCTGACAAGATGTTCCTAAGGAAGATGCTTCAGG
GTGGAACCGGAACTTCTGAAACCGCCGACAAGATCTTCAA
GAGTGAGATGGAGAGCCGACTTACTGGTGGAGTTCCATGT
GGTGAGAGTTGCGTTTTCATACCATGCTTAACCGCCGTCG
TCGGCTGCTCGTGCAGTAACAAAGTATGTTACCTAAACGA
ATTGCCCCCAGCTGCTGTCTCTGCATAAGAAAGCCAATGA
AGAAGATCTACGAATCTGAATTGTGTGTTGCCTTTTATTT
TGTGTGACCTCTTCATGACGATCGACATGAAGAGAGATGA
TGTACGTCTTTCCTTTTCCGTGTTGTTCTGAAATAAATGA
AGGTTTTTAAAAAAAAAAAAAAAAA
Notes
Sequence translation VLGVAASGHDKTALVNEITEMLAGVETFEAKLDKAALVSE
MADKVFLRKMLSGVDIEKADKKALVKEISDKMFLRKMLQG
GTGTSETADKIFKSEMESRLTGGVPCGESCVFIPCLTAVV
GCSCSNKVCYLNELPPAAVSA
Organism Oldenlandia affinis

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646

Cross-references
Proteins Encoded Oak8 precursor
Links