Gbc6(101) Nucleic Acid Card

General Information
Name Gbc6
Sequence gctgctttcgctcttccagctcttgcaacctttgaaaaag
atgtgatcactcccgagaccattcaggctgttcttaagag
aactgctcccctttccaacattatgctagagggggatgcc
atcaacgctcttattacgggcaagaccgttatctcaaaaa
ctgtgcttgaggaggcactccttaaaaatgatggtcttgg
gggcgttattccctgtggtgagagttgcgtctttattcct
tgcatctctagcgttcttgggtgttcttgcaagaacaaag
tttgctacaggaactctcttgttaactaagaccaattatg
tatcactggattatgtgttcttgttgtcctgaggaagcta
tatatgcttgtaacatatataccataaaattatgtcaagc
atgcttccatgttatttctcttcaagtttaataaatgttt
gtgtatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Notes This sequence was named Gbc5 in the NCBI nucleotide database, but we have adopted the name published in the original article Burman et al 2010.
Sequence translation AAFALPALATFEKDVITPETIQAVLKRTAPLSNIMLEGDA
INALITGKTVISKTVLEEALLKNDGLGGVIPCGESCVFIP
CISSVLGCSCKNKVCYRNSLVN
Organism Gloeospermum blakeanum (Standl.) Hekking

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Proteins Encoded Gbc6 precursor
Links