theta defensin 1b precursor(10) Nucleic Acid Card

General Information
Name theta defensin 1b precursor
Sequence GACCGCTGCTCTTGCTACAGGAGACCCGGGACAGAGGACT
GCTGTCTGCCCTCTCTCTTCACTCTGCCTAACTTGAGGAT
CTGCCAGCCATGAGGACCTTCGCCCTCCTCACCGCCATGC
TTCTCCTGGTGGCCCTGCACGCTCAGGCAGAGGCACGTCA
GGCAAGAGCTGATGAAGCTGCCGCCCAGCAGCAGCCTGGA
GCAGATGATCAGGGAATGGCTCATTCCTTTACACGGCCTG
AAAACGCCGCTCTTCCGCTTTCAGAGTCAGCGAGAGGCTT
GAGGTGCCTTTGCAGACGAGGAGTTTGCCAACTGTTATAA
AGGCGTTTGGGGTCCTGCGCTTTTCGTGGTTGACTCTGCC
GGATCTGCTGCCGCTGAGCTTCCAGAATCAAGAAAAATAC
GCTCAGAAGTTACTTTGAGAGTTGAAAGAAATTCCTGTTA
CTCCTGTACCTTGTCCTCAATTTCCTTTTCTCATCCCAAA
TAAATACCTTCTCGC
Notes Along with 1a forms RTD-1 and two copies forms RTD-3.
Sequence translation MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGADD
QGMAHSFTRPENAALPLSESARGLRCLCRRGVCQLL
Organism Macaca mulatta (rhesus monkey)

References
Tang YQ, Yuan J, Osapay G, Osapay K, Tran D, Miller CJ, Ouellette AJ, Selsted ME (1999) A cyclic antimicrobial peptide produced in primate leukocytes by the ligation of two truncated alpha-defensins. Science 286:498-502

Cross-references
Proteins Encoded RTD-1
RTD-3
RTD-1b
Links