kalata B2 precursor [OaK4](1) Nucleic Acid Card

General Information
Name kalata B2 precursor [OaK4]
Sequence GGCACCAGATACAACCCCTTTCTTATAATTTATTGCTTTT
CTTATTCCTTGAAAAAGGAGAAATAATATTGGATCTTCCA
TGGCTAAGTTCACCAACTGTCTCGTCCTGAGCTTGCTTCT
AGCAGCATTTGTTGGGGCTTTCGGAGCTGAGTTTTCTGAA
GCCGACAAGGCCACCTTGGTCAATGATATCGCTGAGAATA
TCCAAAAAGAGATACTGGGCGAAGTGAAGACTTCTGAAAC
CGTCCTTACGATGTTCCTGAAAGAGATGCAGCTCAAAGGT
CTTCCAGTATGCGGCGAGACTTGCTTTGGGGGAACTTGCA
ACACTCCAGGCTGCTCTTGCACCTGGCCTATCTGCACACG
CGATAGCCTTCCTATGAGGGCTGGAGGAAAAACATCTGAA
ACCACCCTTCATATGTTCCTGAAAGAGATGCAGCTCAAGG
GTCTTCCAGTTTGCGGCGAGACTTGCTTTGGGGGAACTTG
CAACACTCCAGGCTGCTCGTGCACCTGGCCTATCTGCACA
CGCGATAGCCTTCCTATGAGTGCTGGAGGAAAAACATCTG
AAACCACCCTTCATATGTTCCTGAAAGAGATGCAGCTCAA
GGGTCTTCCAGTTTGCGGCGAGACTTGCTTTGGGGGAACT
TGCAACACTCCAGGCTGCTCGTGCACCTGGCCTATATGCA
CACGTGATAGCCTTCCTCTTGTGGCTGCATAATTTGCTTC
ATCAAACTGCAAAATGAATAAGAAGGGACACTAAATTAGC
TATGAATTTTGTTGGCCCTTGTGTCTGGTAATTTGGTTCC
CGCCAAATTAACCATATGTATGCATTGCTCCTTTTTTCTT
TCTTTTTTTTCCCCCTCATTTGGGCACTCTTCATTACATG
AAGAGATCATGACGCTTTGTTACTCTGAGCACCCCCTGTT
GGTGTTGTTCACATGTTGATGCCCATGTTGGAATAAACTC
TTGTTTTTGTTACCAAAAAAAAAAAAAAAAAAA
Notes
Sequence translation MAKFTNCLVLSLLLAAFVGAFGAEFSEADKATLVNDIAEN
IQKEILGEVKTSETVLTMFLKEMQLKGLPVCGETCFGGTC
NTPGCSCTWPICTRDSLPMRAGGKTSETTLHMFLKEMQLK
GLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMSAGGKTS
ETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPIC
TRDSLPLVAA
Organism Oldenlandia affinis

References
Jennings C, West J, Waine C, Craik D, Anderson M (2001) Biosynthesis and insecticidal properties of plant cyclotides: the cyclic knotted proteins from Oldenlandia affinis. Proc Natl Acad Sci U S A 98:10614-9

Cross-references
Proteins Encoded kalata B2
kalata B2 precursor
Oantr protein
Links